| Edit |   |
| Antigenic Specificity | Family with Sequence Similarity 3, Member D (FAM3D) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of FAM3 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | FAM3 D antibody was raised using the middle region of FAM3 corresponding to a region with amino acids LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP |
| Other Names | Oit1|EF7|OIT1|2310076N21Rik|AV067083|EF-7|Fam3d |
| Gene, Accession # | Gene ID: 131177 |
| Catalog # | ABIN633145 |
| Price | |
| Order / More Info | Family with Sequence Similarity 3, Member D (FAM3D) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |