| Edit |   |
| Antigenic Specificity | Solute Carrier Family 25, Member 28 (SLC25A28) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme. |
| Immunogen | SLC25 A28 antibody was raised using the C terminal of SLC25 28 corresponding to a region with amino acids NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST |
| Other Names | MFRN2|MRS3/4|MRS4L|2210403D18Rik|Mfrn2|Mrs3/4|wu:fc48b02|wu:fc66h02|zgc:64212 |
| Gene, Accession # | Gene ID: 81894 |
| Catalog # | ABIN635044 |
| Price | |
| Order / More Info | Solute Carrier Family 25, Member 28 (SLC25A28) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |