| Edit |   |
| Antigenic Specificity | Solute Carrier Family 47, Member 2 (SLC47A2) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. |
| Immunogen | SLC47 A2 antibody was raised using the C terminal of SLC47 2 corresponding to a region with amino acids TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV |
| Other Names | RGD1562382|MATE2|DKFZp469G161|SLC47A2|MATE2-B|MATE2-K|MATE2K|4933429E10Rik |
| Gene, Accession # | Gene ID: 146802 |
| Catalog # | ABIN631558 |
| Price | |
| Order / More Info | Solute Carrier Family 47, Member 2 (SLC47A2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |