| Edit |   |
| Antigenic Specificity | Solute Carrier Family 38 Member 1 (SLC38A1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate. |
| Immunogen | SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN |
| Other Names | ATA1|NAT2|SAT1|SNAT1|AA408026|AA409865|AL022800|AU015942|Ata1|GlnT|Sat1 |
| Gene, Accession # | Gene ID: 81539 |
| Catalog # | ABIN630327 |
| Price | |
| Order / More Info | Solute Carrier Family 38 Member 1 (SLC38A1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |