| Edit |   |
| Antigenic Specificity | Solute Carrier Family 43, Member 1 (SLC43A1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids. |
| Immunogen | SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI |
| Other Names | LAT3|PB39|POV1|R00504|2610016F07Rik|AA986141|Lat3|Pov1 |
| Gene, Accession # | Gene ID: 8501 |
| Catalog # | ABIN634904 |
| Price | |
| Order / More Info | Solute Carrier Family 43, Member 1 (SLC43A1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |