| Edit |   |
| Antigenic Specificity | Solute Carrier Family 43, Member 2 (SLC43A2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids. |
| Immunogen | SLC43 A2 antibody was raised using the N terminal of SLC43 2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS |
| Other Names | lat4|MGC122003|si:dkey-118k5.2|slc43a2|zgc:56271|LAT4|RGD1305819|7630402D21Rik|BC042513|Lat4|DKFZp469D1521 |
| Gene, Accession # | Gene ID: 124935 |
| Catalog # | ABIN634843 |
| Price | |
| Order / More Info | Solute Carrier Family 43, Member 2 (SLC43A2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |