| Edit |   |
| Antigenic Specificity | Solute Carrier Family 43, Member 3 (SLC43A3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC43A3 belongs to the SLC43A transporter family and is a putative transporter. |
| Immunogen | SLC43 A3 antibody was raised using the N terminal of SLC43 3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD |
| Other Names | SLC43A3|EEG1|FOAP-13|PRO1659|SEEEG-1|Eeg1 |
| Gene, Accession # | Gene ID: 29015 |
| Catalog # | ABIN630461 |
| Price | |
| Order / More Info | Solute Carrier Family 43, Member 3 (SLC43A3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |