| Edit |   |
| Antigenic Specificity | TP53 Apoptosis Effector (PERP) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway. |
| Immunogen | PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG |
| Other Names | PERP|PERPL|kcp1|krtcap1|pigpc1|thw|fk24g11|wu:fk24g11|LOC100221212|1110017A08Rik|KCP1|KRTCAP1|PIGPC1|THW|RP3-496H19.1|dJ496H19.1 |
| Gene, Accession # | Gene ID: 64065 |
| Catalog # | ABIN635864 |
| Price | |
| Order / More Info | TP53 Apoptosis Effector (PERP) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |