| Edit |   |
| Antigenic Specificity | Developmentally Regulated GTP Binding Protein 1 (DRG1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death. |
| Immunogen | DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL |
| Other Names | xdrg1|MGC122865|wu:fb06g12|zgc:64124|NEDD3|AA408859|AI132520|Nedd3|xdrg|CAP43|CMT4D|DRG1|HMSNL|NMSL|Ndr1|Ndrl|PROXY1|RTP|TDD5 |
| Gene, Accession # | Gene ID: 4733,17988,305470 |
| Catalog # | ABIN631526 |
| Price | |
| Order / More Info | Developmentally Regulated GTP Binding Protein 1 (DRG1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |