| Edit |   |
| Antigenic Specificity | Developmental Pluripotency Associated 2 (DPPA2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers. |
| Immunogen | DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL |
| Other Names | 2410088E07Rik|C80932|D19Mgi18|ECAT15-2|CT100|PESCRG1 |
| Gene, Accession # | Gene ID: 151871 |
| Catalog # | ABIN630962 |
| Price | |
| Order / More Info | Developmental Pluripotency Associated 2 (DPPA2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |