| Edit |   |
| Antigenic Specificity | Acetyl-CoA Acetyltransferase 2 (ACAT2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. |
| Immunogen | ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
| Other Names | Ab2-076|Acat3|AW742799|Tcp-1x|Tcp1-rs1 |
| Gene, Accession # | Gene ID: 39 |
| Catalog # | ABIN629655 |
| Price | |
| Order / More Info | Acetyl-CoA Acetyltransferase 2 (ACAT2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |