| Edit |   |
| Antigenic Specificity | Acetyl-CoA Acyltransferase 1 (ACAA1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. |
| Immunogen | ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
| Other Names | acaa|pthio|thio|ACAA|PTHIO|THIO|Acaa|Acaa1|Pktaa|zgc:92385|D9Ertd25e|PTL |
| Gene, Accession # | Gene ID: 30,24157 |
| Catalog # | ABIN631524 |
| Price | |
| Order / More Info | Acetyl-CoA Acyltransferase 1 (ACAA1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |