| Edit |   |
| Antigenic Specificity | Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1. |
| Immunogen | CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM |
| Other Names | cam2|camk2|camk2g|camkII|camkb|CaMKII|R74975|mKIAA0968|CAMK|CAMK-II|CAMKG|5930429P18Rik|Camkg |
| Gene, Accession # | Gene ID: 818 |
| Catalog # | ABIN634349 |
| Price | |
| Order / More Info | Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |