| Edit |   |
| Antigenic Specificity | N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. It modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. NDST4 has low deacetylase activity but high sulfotransferase activity. |
| Immunogen | NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ |
| Other Names | NDST-4|NHSST4|4930439H17Rik |
| Gene, Accession # | Gene ID: 64579,64580,362035 |
| Catalog # | ABIN635713 |
| Price | |
| Order / More Info | N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |