| Edit |   |
| Antigenic Specificity | Lipocalin 8 (LCN8) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. |
| Immunogen | Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN |
| Other Names | ESP20.5|EP17|LCN5|9230106L18Rik|Lcn5|mEP17|RGD1306747 |
| Gene, Accession # | Gene ID: 138307 |
| Catalog # | ABIN631798 |
| Price | |
| Order / More Info | Lipocalin 8 (LCN8) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |