| Edit |   |
| Antigenic Specificity | Lipocalin 12 (LCN12) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis. |
| Immunogen | Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG |
| Other Names | 9230102M18Rik |
| Gene, Accession # | Gene ID: 286256 |
| Catalog # | ABIN634058 |
| Price | |
| Order / More Info | Lipocalin 12 (LCN12) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |