| Edit |   |
| Antigenic Specificity | GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. |
| Immunogen | G3 BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP |
| Other Names | fj17h05|zgc:56034|wu:fj17h05|g3bp|MGC53271|G3BP1|G3BP|HDH-VIII|G3bp|RGD1310666|AI849976|B430204O07|C87777|mKIAA4115|AA409541|E430034L04Rik|mKIAA0660 |
| Gene, Accession # | Gene ID: 10146,27041,171092 |
| Catalog # | ABIN634465 |
| Price | |
| Order / More Info | GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |