| Edit |   |
| Antigenic Specificity | UBE2G1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human UBE2G1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYE |
| Other Names | ubiquitin-conjugating enzyme E2G 1, UBC7, UBE2G |
| Gene, Accession # | Gene ID: 7326, UniProt: P62253, ENSG00000132388 |
| Catalog # | HPA045681 |
| Price | |
| Order / More Info | UBE2G1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |