| Edit |   |
| Antigenic Specificity | Discs, Large Homolog 3 (Drosophila) (DLG3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90). |
| Immunogen | DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF |
| Other Names | Dlgh3|MRX|MRX90|NEDLG|SAP102|XLMR|mKIAA1232|fa66c08|fa66e02|fd02c12|fu95c12|im:7138640|si:ch211-276g21.1|wu:fa66c08|wu:fa66e02|wu:fd02c12|wu:fu95c12|MPP3 |
| Gene, Accession # | Gene ID: 1741,53310,58948 |
| Catalog # | ABIN635101 |
| Price | |
| Order / More Info | Discs, Large Homolog 3 (Drosophila) (DLG3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |