| Edit |   |
| Antigenic Specificity | GPR171 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 69%, rat 69%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GPR171 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LSKAFRSKVTETFASPKETKAQKEKLRCENNA |
| Other Names | G protein-coupled receptor 171, H963 |
| Gene, Accession # | Gene ID: 29909, UniProt: O14626, ENSG00000174946 |
| Catalog # | HPA062429 |
| Price | |
| Order / More Info | GPR171 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |