| Edit |   |
| Antigenic Specificity | Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5. |
| Immunogen | SLC1 A1 antibody was raised using the N terminal Of Slc1 1 corresponding to a region with amino acids VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN |
| Other Names | GB16911|EAAT3|SLC1A2a|zgc:91959|EAAC1|SCZD18|D130048G10Rik|EAAC2|MEAAC1|Eaac1|Eaat3|REAAC1 |
| Gene, Accession # | Gene ID: 6505 |
| Catalog # | ABIN635938 |
| Price | |
| Order / More Info | Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |