| Edit |   |
| Antigenic Specificity | Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. |
| Immunogen | SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE |
| Other Names | SLC6A5|Glyt2|prestin|GLYT-2|GLYT2|HKPX3|NET1 |
| Gene, Accession # | Gene ID: 9152 |
| Catalog # | ABIN635139 |
| Price | |
| Order / More Info | Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |