| Edit |   |
| Antigenic Specificity | Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites. |
| Immunogen | SLC6 A15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS |
| Other Names | B0AT2|AA536730|AI326450|AI326451|v7-3|NTT73|SBAT1|V7-3|hv7-3|Ntt73 |
| Gene, Accession # | Gene ID: 55117 |
| Catalog # | ABIN635136 |
| Price | |
| Order / More Info | Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |