| Edit |   |
| Antigenic Specificity | Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine. |
| Immunogen | SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV |
| Other Names | Slc29a2|MGC63618|ent2|der12|hnp36|MGC82995|DKFZp468L038|DER12|ENT2|HNP36|Der12|Ent2|Hnp36 |
| Gene, Accession # | Gene ID: 3177 |
| Catalog # | ABIN635738 |
| Price | |
| Order / More Info | Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |