| Edit |   |
| Antigenic Specificity | TCAF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 68%, rat 61%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human TCAF2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: WLARGQTGKVGVNTNLKDLCPLLSEHGLQCSLEPHLNSDLCVYCCKAYSDKEAKQLQEFVAE |
| Other Names | TRPM8 channel associated factor 2, FAM115C, FAM139A, FLJ40722 |
| Gene, Accession # | Gene ID: 285966, UniProt: A6NFQ2, ENSG00000170379 |
| Catalog # | HPA038756 |
| Price | |
| Order / More Info | TCAF2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |