| Edit |   |
| Antigenic Specificity | Mannosidase, Endo-alpha (MANEA) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex. |
| Immunogen | MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV |
| Other Names | fi29h09|zgc:92825|wu:fi29h09|ENDO|hEndo|4932703L02Rik|Enman|manea |
| Gene, Accession # | Gene ID: 79694,242362,140808 |
| Catalog # | ABIN636012 |
| Price | |
| Order / More Info | Mannosidase, Endo-alpha (MANEA) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |