| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PTPN22 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | Flow Cytometry, IHC, ICC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Tyrosine-protein phosphatase non-receptor type 22(PTPN22) detection. Tested with WB, IHC-F, ICC, FCM in Human;Mouse;Rat. No cross reactivity with other proteins. Protein tyrosine phosphatase, non-receptor type 22 (lymphoid), also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene. This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PTPN22 (1-42aa MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK), different from the related mouse sequence by eight amino acids. |
| Other Names | Tyrosine-protein phosphatase non-receptor type 22;3.1.3.48 ;Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP;Lymphoid phosphatase;LyP;PEST-domain phosphatase;PEP;PTPN22;PTPN8; |
| Gene, Accession # | PTPN22, UniProt: Q9Y2R2 |
| Catalog # | PB9784 |
| Price | |
| Order / More Info | PTPN22 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|