| Edit |   |
| Antigenic Specificity | Phosphoglucomutase 3 (PGM3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P. |
| Immunogen | PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL |
| Other Names | pgm3|MGC69105|wu:fc08c11|wu:fc39c03|zgc:91932|PGM3|AGM1|PAGM|PGM 3|2810473H05Rik|Agm1|BB187688|C77933|Pgm-3 |
| Gene, Accession # | Gene ID: 5238,109785,363109 |
| Catalog # | ABIN633023 |
| Price | |
| Order / More Info | Phosphoglucomutase 3 (PGM3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |