| Edit |   |
| Antigenic Specificity | HTRA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 91%, rat 91%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human HTRA1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA |
| Other Names | HtrA serine peptidase 1, ARMD7, HtrA, IGFBP5-protease, PRSS11 |
| Gene, Accession # | Gene ID: 5654, UniProt: Q92743, ENSG00000166033 |
| Catalog # | HPA036655 |
| Price | |
| Order / More Info | HTRA1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |