| Edit |   |
| Antigenic Specificity | Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Proteins that contain formin homology (FH) domains, such as FHOD3, play a role in regulation of the actin cytoskeleton. |
| Immunogen | FHOD3 antibody was raised using the C terminal of FHOD3 corresponding to a region with amino acids SGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPALGV |
| Other Names | FHOS2|Formactin2|A930009H06Rik|mKIAA1695 |
| Gene, Accession # | Gene ID: 80206 |
| Catalog # | ABIN630729 |
| Price | |
| Order / More Info | Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |