If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
Immunogen
TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL