| Edit |   |
| Antigenic Specificity | Interferon-Induced Protein 44 (IFI44) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This protein aggregates to form microtubular structures. |
| Immunogen | IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS |
| Other Names | MATP44|MTAP44|TLDC5|p44|A430056A10Rik|AW261460 |
| Gene, Accession # | Gene ID: 10561 |
| Catalog # | ABIN632234 |
| Price | |
| Order / More Info | Interferon-Induced Protein 44 (IFI44) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |