| Edit |   |
| Antigenic Specificity | Interferon-Induced Protein 35 (IFI35) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | IFI35 has been shown to interact with NMI and BATF. |
| Immunogen | IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL |
| Other Names | IFI35|IFP35|2010008K16Rik|AW986054|ifi-35 |
| Gene, Accession # | Gene ID: 3430 |
| Catalog # | ABIN630552 |
| Price | |
| Order / More Info | Interferon-Induced Protein 35 (IFI35) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |