| Edit |   |
| Antigenic Specificity | Kelch Domain Containing 2 (KLHDC2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats. |
| Immunogen | KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV |
| Other Names | MGC82652|HCLP-1|HCLP1|LCP|2310022K15Rik|D12Ertd522e |
| Gene, Accession # | Gene ID: 23588,69554,299113 |
| Catalog # | ABIN632311 |
| Price | |
| Order / More Info | Kelch Domain Containing 2 (KLHDC2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |