If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. PCDHGC3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
Immunogen
PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY