| Edit |   |
| Antigenic Specificity | Leucine Rich Repeat Containing 4C (LRRC4C) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons. |
| Immunogen | LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE |
| Other Names | fd12d10|wu:fd12d10|zgc:110565|NGL-1|NGL1|6430556C10Rik|mKIAA1580|RGD1311013 |
| Gene, Accession # | Gene ID: 57689,241568,311236 |
| Catalog # | ABIN635150 |
| Price | |
| Order / More Info | Leucine Rich Repeat Containing 4C (LRRC4C) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |