| Edit |   |
| Antigenic Specificity | ETNK2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 73%, rat 76%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ETNK2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQEL |
| Other Names | ethanolamine kinase 2, EKI2, FLJ10761 |
| Gene, Accession # | Gene ID: 55224, UniProt: Q9NVF9, ENSG00000143845 |
| Catalog # | HPA057167 |
| Price | |
| Order / More Info | ETNK2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |