| Edit |   |
| Antigenic Specificity | MYH9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 88%, rat 87%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human MYH9 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA |
| Other Names | myosin heavy chain 9, DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHCA |
| Gene, Accession # | Gene ID: 4627, UniProt: P35579, ENSG00000100345 |
| Catalog # | HPA064783 |
| Price | |
| Order / More Info | MYH9 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |