| Edit |   |
| Antigenic Specificity | Chromodomain Protein, Y-Linked, 1 (CDY1) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. |
| Immunogen | CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF |
| Other Names | CDY|CDY1A|CDY2A|CDY1|CDY2|CDY1B|CDY2B |
| Gene, Accession # | Gene ID: 9085 |
| Catalog # | ABIN629620 |
| Price | |
| Order / More Info | Chromodomain Protein, Y-Linked, 1 (CDY1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |