| Edit |   |
| Antigenic Specificity | Acyl-CoA Binding Domain Containing 5 (ACBD5) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known. |
| Immunogen | ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK |
| Other Names | MGC89100|F15A18.90|F15A18_90|acyl-CoA binding protein 5|1300014E15Rik |
| Gene, Accession # | Gene ID: 91452,74159,307170 |
| Catalog # | ABIN635304 |
| Price | |
| Order / More Info | Acyl-CoA Binding Domain Containing 5 (ACBD5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |