| Edit |   |
| Antigenic Specificity | Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. |
| Immunogen | ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV |
| Other Names | ACAD6|LCACD|VLCAD|fb52d04|wu:fb52d04|wu:fc75e01|zgc:64067|vlcad |
| Gene, Accession # | Gene ID: 37,25363 |
| Catalog # | ABIN630886 |
| Price | |
| Order / More Info | Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |