| Edit |   |
| Antigenic Specificity | Adenylate Kinase 3 (AK3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AK3 protein is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. |
| Immunogen | AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT |
| Other Names | AK3|CG6612|DAK3|Dak3|Dmel\\CG6612|bs12h03.y1|ak3l1|sb:cb845|zgc:64135|id:ibd3034|wu:fa02c11|wu:fc20h08|AK3L1|AK4|MGC114646|wu:fc37g02|zgc:85790|AK3L2|ak4|NV16713|ak6|AK6|AKL3L|AKL3L1|FIX|AA407498|AI506714|AK-3|Ak3l|Ak3l1|Akl3l |
| Gene, Accession # | Gene ID: 50808,56248,26956 |
| Catalog # | ABIN634447 |
| Price | |
| Order / More Info | Adenylate Kinase 3 (AK3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |