| Edit |   |
| Antigenic Specificity | Adenylate Kinase 5 (AK5) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
| Immunogen | AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY |
| Other Names | wu:fj63a06|AK6|AK 5 |
| Gene, Accession # | Gene ID: 26289 |
| Catalog # | ABIN632129 |
| Price | |
| Order / More Info | Adenylate Kinase 5 (AK5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |