| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | AAAS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AAAS Antibody from Novus Biologicals is a rabbit polyclonal antibody to AAAS. This antibody reacts with human. The AAAS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AAAS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLITFHPSFNKGALLSVGWSTGRIAHIPLYFVNAQFPRFSPVLGRAQEPPAGGGGSIHDLPLFTETSPTSAPWDPLPGPPPVLPHS |
| Other Names | AAA, AAASb, achalasia, adrenocortical insufficiency, alacrimia, achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A), ADRACALA, Adracalin, ALADIN, Allgrove, triple-A, DKFZp586G1624 |
| Gene, Accession # | AAAS, Gene ID: 8086, Accession: Q9NRG9, SwissProt: Q9NRG9 |
| Catalog # | NBP1-89424 |
| Price | |
| Order / More Info | AAAS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|