| Edit |   |
|---|
| Antigenic Specificity | Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. |
|---|
| Immunogen | ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
|---|
| Other Names | ABP|ABP1|DAO|DAO1|KAO|abp1|si:ch211-286c5.2|zgc:154101|Abp|Abp1|dao|1600012D06Rik|AI987963|Dao-1|Dao1 |
|---|
| Gene, Accession # | Gene ID: 26 |
|---|
| Catalog # | ABIN634013 |
|---|
| Price | |
|---|
| Order / More Info | Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|