| Edit |   |
|---|
| Antigenic Specificity | Hepatocyte Nuclear Factor 4 gamma (HNF4G) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse |
|---|
| Immunogen | HNF4 G antibody was raised using the C terminal of HNF4 corresponding to a region with amino acids QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS |
|---|
| Other Names | HNF4G|hnf4gamma|zgc:153265|NR2A2|NR2A3 |
|---|
| Gene, Accession # | Gene ID: 3174,30942,365744 |
|---|
| Catalog # | ABIN630491 |
|---|
| Price | |
|---|
| Order / More Info | Hepatocyte Nuclear Factor 4 gamma (HNF4G) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|