| Edit |   |
| Antigenic Specificity | MLIP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 70%, rat 68%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human MLIP polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI |
| Other Names | muscular LMNA interacting protein, C6orf142, CIP, MGC18257 |
| Gene, Accession # | Gene ID: 90523, UniProt: Q5VWP3, ENSG00000146147 |
| Catalog # | HPA029252 |
| Price | |
| Order / More Info | MLIP Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |