| Edit |   |
|---|
| Antigenic Specificity | ELA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (predicted: mouse, rat) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ul |
|---|
| Concentration | >0.5mg/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ELA1 Antibody validated for WB |
|---|
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal of human ELA1, in this region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT. It shares 77% with mouse ELA1 and 95% with rat ELA1. |
|---|
| Other Names | Chymotrypsin-like elastase family member 1;3.4.21.36;Elastase-1;Pancreatic elastase 1;CELA1;ELA1; |
|---|
| Gene, Accession # | CELA1, UniProt: Q9UNI1 |
|---|
| Catalog # | A08353 |
|---|
| Price | |
|---|
| Order / More Info | ELA1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|