| Edit |   |
| Antigenic Specificity | RABAC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 95%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human RABAC1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRP |
| Other Names | Rab acceptor 1 (prenylated), PRA1, PRAF1, YIP3 |
| Gene, Accession # | Gene ID: 10567, UniProt: Q9UI14, ENSG00000105404 |
| Catalog # | HPA029171 |
| Price | |
| Order / More Info | RABAC1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |