| Edit |   |
| Antigenic Specificity | Glutathione Peroxidase 3 (Plasma) (GPX3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. |
| Immunogen | GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |
| Other Names | GPX3|DKFZp469D1932|AA960521|EGPx|GPx|GSHPx-3|GSHPx-P|GPx-3|GPx-P|Gpxp |
| Gene, Accession # | Gene ID: 2878,14778,64317 |
| Catalog # | ABIN633878 |
| Price | |
| Order / More Info | Glutathione Peroxidase 3 (Plasma) (GPX3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |